Record in detail


General Info

  • lamp_id:L02A001623
  • Name:Sushi peptide 1
  • FullName:Sushi peptide 1
  • Source:Protein-derived, synthetic
  • Mass:3757.4 Da
  • Sequence Length:34 aa
  • Isoelectric Point:9.72
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001623    From 1 To 34 E-value: 0.000000000000001 Score: 73.2
        GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS
  • 2. L13A025464    From 1 To 34 E-value: 0.00000000000002 Score: 69.7
        GFKLKGKAKISCLPNGQWSNFPPKCIRECAMVSS
  • 3. L11A011818    From 1 To 32 E-value: 0.000001 Score: 43.9
        GFGLGGLARILCLGNRQWSNFFKKLNRKCAMV
  • 4. L11A011819    From 1 To 31 E-value: 0.077 Score: 27.7
        GFALAGLARILCLWFREFSGFFRRLNRRFAM
  • 5. L01A003438    From 8 To 39 E-value: 2.6 Score: 22.7
        KLRGTCKNSCEKNEELTSFCQKSLKCCRTIQT

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: