Record in detail


General Info

  • lamp_id:L02A001642
  • Name:VpBD
  • FullName:VpBD
  • Source:The manila clam, Venerupis philippinarum
  • Mass:8921.2 Da
  • Sequence Length:74 aa
  • Isoelectric Point:8.93
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEPVRGNIDCYFGYNCCRRMFSHYRTS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001642    From 1 To 74 E-value: 3e-40 Score: 155
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEPVRGNIDCYFGYNCCRRMFSHYRTS
  • 2. L13A010564    From 1 To 50 E-value: 7e-25 Score: 104
        LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEP
  • 3. L12A07992|    From 27 To 44 E-value: 0.16 Score: 26.6
        CLSNRGFCRSSCKKDEQP
  • 4. L12A08357|    From 26 To 70 E-value: 0.2 Score: 26.2
        PRRQTMEKEKKCENNEGFCRKKCKAEEVELR---YCLSGKMCCISTYS
  • 5. L12A06386|    From 46 To 76 E-value: 0.22 Score: 26.2
        CWLGRGKCRKICTE-DEKIVGN--CKVNFFCCRR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: