Record in detail


General Info

  • lamp_id:L02A001646
  • Name:gcLEAP-2
  • FullName:gcLEAP-2
  • Source:Chinese grass carp, Ctenopharyngodon idella
  • Mass:4657.3 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.66
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        MTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYSQPINS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001646    From 1 To 41 E-value: 2e-20 Score: 89.7
        MTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYSQPINS
  • 2. L12A07803|    From 54 To 94 E-value: 1e-19 Score: 87
        MTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCSFSQPIIS
  • 3. L12A07794|    From 52 To 92 E-value: 8e-19 Score: 84
        MTPLWRTVGTKPHGAYCQNNYECSTGICRMGHCSYSQPVNS
  • 4. L01A003808    From 43 To 78 E-value: 2e-18 Score: 82.8
        MTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYS
  • 5. L01A003990    From 38 To 73 E-value: 1e-17 Score: 80.5
        MTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCSFS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: