Record in detail


General Info

  • lamp_id:L02A001651
  • Name:Garvicin ML
  • FullName:Garvicin ML
  • Source:Lactococcus garvieae DCC43
  • Mass:6025.2 Da
  • Sequence Length:60 aa
  • Isoelectric Point:10.85
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001651    From 1 To 60 E-value: 2e-27 Score: 112
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • 2. L12A06910|    From 4 To 63 E-value: 2e-27 Score: 112
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • 3. L13A010490    From 1 To 50 E-value: 1e-21 Score: 93.6
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQ
  • 4. L12A08466|    From 5 To 50 E-value: 0.025 Score: 29.3
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVK
  • 5. L01A002781    From 1 To 46 E-value: 0.031 Score: 28.9
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: