Record in detail


General Info

  • lamp_id:L02A001652
  • Name:Lactocyclicin Q
  • FullName:Lactocyclicin Q
  • Source:Lactococcus sp. strain QU 12
  • Mass:6078.1 Da
  • Sequence Length:61 aa
  • Isoelectric Point:10.5
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08016|    From 3 To 63 E-value: 2e-27 Score: 113
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • 2. L02A001652    From 1 To 61 E-value: 2e-27 Score: 112
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • 3. L13A010829    From 1 To 50 E-value: 2e-21 Score: 92.8
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 4. L12A06081|    From 1 To 61 E-value: 3e-19 Score: 85.5
        LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW
  • 5. L04ABAC209    From 3 To 63 E-value: 5e-19 Score: 84.7
        LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATKAALATAETIVKHEGKAAAIAW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: