Record in detail


General Info

  • lamp_id:L02A001690
  • Name:DEF2_SINAL
  • FullName:Defensin-like protein 2
  • Source:Sinapis alba
  • Mass:5565.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.6
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • Function:Inhibits bovine beta-trypsin and alpha-chymotrypsin on a 1:1 molar basis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002125    From 31 To 80 E-value: 3e-26 Score: 108
        KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 2. L12A06263|    From 31 To 80 E-value: 4e-26 Score: 108
        KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 3. L03A000092    From 31 To 80 E-value: 7e-26 Score: 107
        KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
  • 4. L03A000096    From 31 To 80 E-value: 2e-25 Score: 105
        KLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 5. L02A001690    From 1 To 50 E-value: 4e-25 Score: 105
        KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC

Structure

  •   Domains
  •   1  Name:Knot1    Interpro Link:IPR003614
  •   2  Name:Scorpion_toxinL/defesin    Interpro Link:IPR002061
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ascenzi P.,Bortolotti F.,Ronchi S.,Tedeschi G.,Menegatti E.,
  •   Title:Purification, inhibitory properties and amino acid sequence of a new serine proteinase inhibitor from white mustard (Sinapis alba L.) seed.
  •   Journal:FEBS Lett., 1992, 301, 10-14  [MEDLINE:93083607]
  •   [2]  Gallerani R.,de Virgilio M.,Spoto N.,Ceci L.R.,
  •   Title:The gene coding for the mustard trypsin inhibitor-2 is discontinuous and wound-inducible.
  •   Journal:FEBS Lett., 1995, 364, 179-181  [MEDLINE:95269796]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: