Record in detail


General Info

  • lamp_id:L02A001749
  • Name:cc-CATH2
  • FullName:cc-CATH2 (C. coturnix cathelicidin; birds, animals)
  • Source:common quail, Coturnix coturnix
  • Mass:3715.5 Da
  • Sequence Length:32 aa
  • Isoelectric Point:13.21
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        LVQRGRFGRFLKKVRRFIPKVIIAAQIGSRFG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001749    From 1 To 32 E-value: 0.000000000006 Score: 61.2
        LVQRGRFGRFLKKVRRFIPKVIIAAQIGSRFG
  • 2. L01A003102    From 1 To 32 E-value: 0.0000004 Score: 45.4
        LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG
  • 3. L12A06085|    From 1 To 31 E-value: 0.000001 Score: 43.5
        LVQRGRFGRFLRKIRRFRPKVTITIQGSARF
  • 4. L12A06087|    From 1 To 32 E-value: 0.000003 Score: 42.4
        LVQRGRFGRFLSKIRRFRPKFTITIQGSGRFG
  • 5. L02A000548    From 1 To 27 E-value: 0.0002 Score: 36.6
        RFGRFLRKIRRFRPKVTITIQGSARFG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: