Record in detail


General Info

  • lamp_id:L02A001751
  • Name:Papiliocin
  • FullName:Papiliocin (insects, invertebrates, animals; ; BBMm; BBL)
  • Source:the swallowtail butterfly, Papilio xuthus
  • Mass:4003.8 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.82
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08526|    From 25 To 61 E-value: 0.000000000000002 Score: 72.8
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • 2. L12A10860|    From 1 To 37 E-value: 0.000000000000006 Score: 71.2
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • 3. L02A001751    From 1 To 37 E-value: 0.000000000000006 Score: 71.2
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • 4. L13A026767    From 1 To 37 E-value: 0.000000000000006 Score: 70.9
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • 5. L12A08525|    From 25 To 61 E-value: 0.00000000000001 Score: 70.1
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVEQAATVVK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: