Record in detail


General Info

  • lamp_id:L02A001755
  • Name:Ir-Def2
  • FullName:Ir-Def2 (I. ricinus defensin 2; hard ticks, arthropod, arachnids, invertebrates, animals)
  • Source:the European tick Ixodes ricinus
  • Mass:4247 Da
  • Sequence Length:37 aa
  • Isoelectric Point:9.45
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002645    From 38 To 74 E-value: 6e-18 Score: 81.3
        GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 2. L01A002628    From 38 To 74 E-value: 4e-17 Score: 78.2
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 3. L02A001755    From 1 To 37 E-value: 1e-16 Score: 76.6
        GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 4. L05ADEF498    From 1 To 37 E-value: 7e-16 Score: 74.3
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 5. L02A001754    From 1 To 37 E-value: 0.000000000000001 Score: 73.9
        GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: