Record in detail


General Info

  • lamp_id:L02A001756
  • Name:ISAMP
  • FullName:ISAMP (Ixodes scapularis antimicrobial peptide; ticks, arthropod, arachnids, invertebrates, animals)
  • Source:The black-legged tick, Ixodes scapularis
  • Mass:5187.8 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        PDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09000|    From 24 To 69 E-value: 1e-23 Score: 100
        PDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR
  • 2. L02A001756    From 1 To 46 E-value: 2e-22 Score: 96.3
        PDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR
  • 3. L13A022303    From 1 To 45 E-value: 6e-22 Score: 94.7
        DPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR
  • 4. L12A09001|    From 24 To 69 E-value: 0.00000000000007 Score: 67.8
        PLPGQAWQVPSKRPKCYSKECTKNEDCKFGSCTYCNNGLWGDNTCR
  • 5. L13A028064    From 19 To 36 E-value: 8.7 Score: 20.8
        PGLSLPQRDMFLCRIGSC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: