Record in detail


General Info

  • lamp_id:L02A001760
  • Name:EcAMP1
  • FullName:EcAMP1 (E. crus-galli AMP 1; 2S=S; plants)
  • Source:seeds, Echinochloa crus-galli
  • Mass:4278.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:9.12
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001760    From 1 To 37 E-value: 0.000000000000001 Score: 73.6
        GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD
  • 2. L13A012134    From 1 To 36 E-value: 0.000000000000004 Score: 72
        SGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD
  • 3. L12A02468|    From 12 To 42 E-value: 0.0000001 Score: 46.6
        SGRGECRRQCLRRHEGQPWETQECMRRCRRR
  • 4. L01A000123    From 2 To 32 E-value: 0.0000002 Score: 46.2
        SGRGECRRQCLRRHEGQPWETQECMRRCRRR
  • 5. L01A001515    From 2 To 26 E-value: 0.00001 Score: 40.4
        SGRGECRRQCLRRHEGQPWETQECM

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: