Record in detail


General Info

  • lamp_id:L02A001768
  • Name:FeCath
  • FullName:FeCath (cathelicidins; domestic cats, animals; BBN)
  • Source:the bone marrow, Felis catus
  • Mass:4323 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.02
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        QLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001768    From 1 To 37 E-value: 0.000000000000002 Score: 72.4
        QLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA
  • 2. L01A002675    From 1 To 36 E-value: 0.000000005 Score: 51.6
        RLKELITTGGQKIGEKIRRIGQRIKDFFKNLQPREE
  • 3. L01A003253    From 1 To 37 E-value: 0.0000001 Score: 47
        QLGDVLQKAGEKIVRGLKNIGQRIKDFFGKLTPRTES
  • 4. L01A003237    From 1 To 37 E-value: 0.00001 Score: 40
        RLGGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTES
  • 5. L01A003119    From 3 To 38 E-value: 0.00003 Score: 39.3
        RLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: