Record in detail


General Info

  • lamp_id:L02A001773
  • Name:Sm-AMP-D2
  • FullName:Sm-AMP-D2 (defensins; plants)
  • Source:seeds, common chickweed, Stellaria media L
  • Mass:5762.5 Da
  • Sequence Length:50 aa
  • Isoelectric Point:7.66
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFNC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001773    From 1 To 50 E-value: 2e-25 Score: 105
        KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFNC
  • 2. L02A001772    From 1 To 50 E-value: 5e-25 Score: 104
        KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFDC
  • 3. L05A0DEF98    From 29 To 78 E-value: 0.00000000000003 Score: 68.9
        RICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • 4. L12A11410|    From 9 To 58 E-value: 0.00000000000006 Score: 67.8
        RICERRSKTWTGFCGNTRGCDSQCKRWERASHGACHAQFPGFACFCYFNC
  • 5. L03A000091    From 30 To 79 E-value: 0.0000000000002 Score: 66.2
        KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: