Record in detail


General Info

  • lamp_id:L02A001775
  • Name:Cliotide T1
  • FullName:Cliotide T1 (cT1; cyclotides; ; Fabaceae, plants; Others: cT5, cT6, cT7, cT8, cT9, cT10, cT11, cT12)
  • Source:Clitoria ternatea
  • Mass:3285.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:4.59
  • Activity:Antibacterial,Antifungal,Antiviral,,Anticancer
  • Sequence
        GEFLKCGESCVQGECYTPGCSCDWPICKKN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001775    From 1 To 30 E-value: 0.0000000000009 Score: 63.9
        GEFLKCGESCVQGECYTPGCSCDWPICKKN
  • 2. L12A01583|    From 61 To 90 E-value: 0.000000009 Score: 50.8
        GSAILCGESCTLGECYTPGCTCSWPICTKN
  • 3. L12A04042|    From 1 To 30 E-value: 0.00000002 Score: 49.7
        GSAIRCGESCLLGKCYTPGCTCDRPICKKN
  • 4. L11A009054    From 1 To 30 E-value: 0.00000004 Score: 48.5
        GSVIKCGESCLLGKCYTPGCTCSRPICKKN
  • 5. L12A00840|    From 1 To 25 E-value: 0.0000001 Score: 47.4
        CGETCVTGTCYTPGCACDWPVCKRD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: