Record in detail


General Info

  • lamp_id:L02A001777
  • Name:Cliotide T1
  • FullName:Cliotide T1 (cT1; cyclotides; ; Fabaceae, plants)
  • Source:Clitoria ternatea
  • Mass:3123.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial,Antifungal,Antiviral,,Anticancer
  • Sequence
        GIPCGESCVFIPCITAAIGCSCKSKVCYRN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001777    From 1 To 30 E-value: 0.000000000006 Score: 61.2
        GIPCGESCVFIPCITAAIGCSCKSKVCYRN
  • 2. L12A04828|    From 1 To 29 E-value: 0.00000000001 Score: 60.1
        IPCGESCVFIPCITGAIGCSCKSKVCYRN
  • 3. L11A004486    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
  • 4. L02A001774    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCGESCVFIPCITGAIGCSCKSKVCYRN
  • 5. L12A12205|    From 59 To 87 E-value: 0.00000000002 Score: 59.7
        IPCGESCVFIPCLTSAIGCSCKSKVCYKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: