Record in detail


General Info

  • lamp_id:L02A001788
  • Name:Myticin C
  • FullName:Myticin C (Myt C; mollusca/molluscs/mollusks, invertebrates, animals; 4S=S)
  • Source:Mytilus galloprovincialis
  • Mass:4705.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:7.97
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A04745|    From 14 To 56 E-value: 3e-20 Score: 88.6
        QEAQSVACTSYYCSKFCGSAGCSLYGCYKLHPGKICYCLHCSR
  • 2. L12A07675|    From 18 To 60 E-value: 9e-20 Score: 87.4
        QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCRR
  • 3. L02A001788    From 1 To 43 E-value: 2e-19 Score: 86.3
        QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
  • 4. L12A07623|    From 18 To 60 E-value: 1e-17 Score: 80.1
        KEAQSASCTSYYCSKFCGTAGCSLYGCYNLTPGKICYCLHCSR
  • 5. L11A012438    From 1 To 40 E-value: 1e-17 Score: 80.1
        QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: