Record in detail


General Info

  • lamp_id:L02A001799
  • Name:WAM1
  • FullName:WAM1 (wallaby antimicrobial 1, MaeuCath1; cathelicidins; Tammar, animals)
  • Source:leukocytes, Macropus eugenii
  • Mass:4276.3 Da
  • Sequence Length:36 aa
  • Isoelectric Point:13.13
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KRGFGKKLRKRLKKFRNSIKKRLKNFNVVIPIPLPG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001799    From 1 To 36 E-value: 0.00000000000009 Score: 67.4
        KRGFGKKLRKRLKKFRNSIKKRLKNFNVVIPIPLPG
  • 2. L11A011802    From 2 To 29 E-value: 0.007 Score: 31.2
        LRKRLRKFRNKIKEKLKKIGQKIQGPLP
  • 3. L11A012533    From 2 To 32 E-value: 0.03 Score: 28.9
        GGGLRKRLRKFRNKIKEKLKKIGQKIQGLLP
  • 4. L11A011801    From 2 To 29 E-value: 0.039 Score: 28.5
        LRKRLRKFRNKIKEKLKKIGQKIQTLLP
  • 5. L02A001800    From 1 To 36 E-value: 0.054 Score: 28.1
        KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: