Record in detail


General Info

  • lamp_id:L02A001800
  • Name:WAM2
  • FullName:WAM2 (wallaby antimicrobial 2, MaeuCath5; cathelicidins; Tammar, animals)
  • Source:leukocytes, Macropus eugenii
  • Mass:4268 Da
  • Sequence Length:36 aa
  • Isoelectric Point:12.05
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001800    From 1 To 36 E-value: 7e-16 Score: 74.3
        KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG
  • 2. L12A06918|    From 38 To 64 E-value: 0.8 Score: 24.3
        KRGLWESIKNLGKKFA---LNIMEKLKCKF
  • 3. L12A07213|    From 38 To 61 E-value: 0.99 Score: 23.9
        KRGLWESIKNFGKKFALNMMNKIK
  • 4. L12A07312|    From 38 To 61 E-value: 1 Score: 23.9
        KRGLWESIKNFGKKFALNMMNKIK
  • 5. L02A001799    From 1 To 36 E-value: 3.2 Score: 22.3
        KRGFGKKLRKRLKKFRNSIKKRLKNFNVVIPIPLPG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: