Record in detail


General Info

  • lamp_id:L02A001810
  • Name:Viphi E
  • FullName:Viphi E (cyclotides; plants; )
  • Source:Viola philippica
  • Mass:3182.7 Da
  • Sequence Length:31 aa
  • Isoelectric Point:7.73
  • Activity:Antibacterial,Antifungal,Antiviral,,Anticancer
  • Sequence
        CGESCVFIPCISAVIGCSCSNKVCYKNGSIP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1810

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001810    From 1 To 31 E-value: 0.000000000005 Score: 61.6
        CGESCVFIPCISAVIGCSCSNKVCYKNGSIP
  • 2. L02A001811    From 1 To 31 E-value: 0.00000000003 Score: 59.3
        CGESCVFIPCISAIIGCSCSSKVCYKNGSIP
  • 3. L12A09593|    From 47 To 77 E-value: 0.00000000008 Score: 57.8
        CGESCVWIPCVSAAIGCSCSNKICYRNGIIP
  • 4. L02A001808    From 1 To 31 E-value: 0.0000000002 Score: 56.2
        CGESCVFIPCISSVIGCACKSKVCYKNGSIP
  • 5. L13A023840    From 1 To 31 E-value: 0.0000000002 Score: 55.8
        CGESCVFIPCITTVLGCSCSIKVCYKNGSIP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: