Record in detail


General Info

  • lamp_id:L02A001812
  • Name:Viphi G
  • FullName:Viphi G (cyclotides; plants; )
  • Source:Viola philippica
  • Mass:3196.7 Da
  • Sequence Length:31 aa
  • Isoelectric Point:7.73
  • Activity:Antibacterial,Antifungal,Antiviral,,Anticancer
  • Sequence
        CEGSCVFIPCISAIIGCSCSNKVCYKNGSIP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1812

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001812    From 1 To 31 E-value: 0.000000000005 Score: 61.2
        CEGSCVFIPCISAIIGCSCSNKVCYKNGSIP
  • 2. L02A001810    From 1 To 31 E-value: 0.0000000003 Score: 55.5
        CGESCVFIPCISAVIGCSCSNKVCYKNGSIP
  • 3. L02A001811    From 1 To 31 E-value: 0.0000000008 Score: 54.3
        CGESCVFIPCISAIIGCSCSSKVCYKNGSIP
  • 4. L13A028674    From 5 To 31 E-value: 0.0000000009 Score: 53.9
        CEGSCVFIPCISAIIGCSCSNKVCYKN
  • 5. L13A018159    From 5 To 31 E-value: 0.0000000009 Score: 53.9
        CEGSCVFIPCISAIIGCSCSNKVCYKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: