Record in detail


General Info

  • lamp_id:L02A001815
  • Name:HIMS-Defensin
  • FullName:HIMS-Defensin (tick,Nuttalliellidae, arachnids, invertebrates, animals)
  • Source:the tick, Haemaphysalis longicornis
  • Mass:5504.6 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.88
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001815    From 1 To 48 E-value: 8e-23 Score: 97.4
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG
  • 2. L11A005817    From 1 To 48 E-value: 3e-22 Score: 95.5
        DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTHIPIRRPPFIMG
  • 3. L12A06166|    From 32 To 78 E-value: 1e-16 Score: 76.6
        DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG
  • 4. L02A001554    From 1 To 47 E-value: 8e-16 Score: 73.9
        DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG
  • 5. L13A014749    From 1 To 46 E-value: 0.000000000000005 Score: 71.6
        FGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPL-RPPFMVG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: