Record in detail


General Info

  • lamp_id:L02A001816
  • Name:Ac-AFP1
  • FullName:Ac-AFP1 (H. coronopifolia antifungal peptide 1; plants; 4S=S)
  • Source:Heliophila coronopifolia, South Africa
  • Mass:5483.1 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.21
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        RYCERSSGTWSGVCGNSGKCSNQCQRLEGAAHGSCNYVFPAHKCICYYPC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001816    From 1 To 50 E-value: 8e-25 Score: 103
        RYCERSSGTWSGVCGNSGKCSNQCQRLEGAAHGSCNYVFPAHKCICYYPC
  • 2. L13A021224    From 1 To 49 E-value: 3e-24 Score: 102
        YCERSSGTWSGVCGNSGKCSNQCQRLEGAAHGSCNYVFPAHKCICYYPC
  • 3. L02A001818    From 1 To 50 E-value: 1e-23 Score: 100
        RYCERSSGTWSGVCGNTDKCSSQCQRLEGAAHGSCNYVFPAHKCICYYPC
  • 4. L13A012240    From 1 To 49 E-value: 6e-23 Score: 97.8
        YCERSSGTWSGVCGNTDKCSSQCQRLEGAAHGSCNYVFPAHKCICYYPC
  • 5. L03A000091    From 30 To 79 E-value: 1e-21 Score: 93.6
        KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: