Record in detail


General Info

  • lamp_id:L02A001916
  • Name:Hedyotide B1
  • FullName:Hedyotide B1 ( cyclotides; plants; inactive: hedyotide B2)
  • Source:Hedyotis biflora
  • Mass:3429 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.38
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001916    From 1 To 30 E-value: 0.0000000000007 Score: 64.3
        GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
  • 2. L12A00838|    From 1 To 27 E-value: 0.000008 Score: 40.8
        CGETCVILPCISAALGCSCKDTVCYKN
  • 3. L12A04186|    From 1 To 30 E-value: 0.000008 Score: 40.8
        GTSCGETCVLLPCLSSVLGCTCQNKRCYKD
  • 4. L02A001095    From 1 To 27 E-value: 0.00001 Score: 40.4
        CGETCVILPCISAALGCSCKDTVCYKN
  • 5. L12A00836|    From 1 To 27 E-value: 0.00002 Score: 39.7
        CGETCVIFPCISAAFGCSCKDTVCYKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: