Record in detail


General Info

  • lamp_id:L02A001919
  • Name:Chensinin-3CE
  • FullName:Chensinin-3CE (frog, amphibians, animals)
  • Source:the Chinese brown frog, Rana chensinensis, China, Asia
  • Mass:5480.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:4.39
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001919    From 1 To 45 E-value: 2e-20 Score: 89.7
        FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR
  • 2. L12A07168|    From 2 To 47 E-value: 0.000000000000002 Score: 72.4
        FTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKR
  • 3. L12A07345|    From 2 To 46 E-value: 0.000000000000003 Score: 72.4
        FTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKR
  • 4. L01A003834    From 2 To 47 E-value: 0.000000000000009 Score: 70.5
        FTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKR
  • 5. L12A07365|    From 2 To 46 E-value: 0.00000000000001 Score: 70.5
        FTTKKPMLLLFFLGTINFSLCEQERDAEEERRDDQDKRDVEVEKR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: