Record in detail


General Info

  • lamp_id:L02A001955
  • Name:Garvieacin Q
  • FullName:Garvieacin Q (GarQ, class 2d bacteriocin, Gram-positive bacteria, lactic acid bacteria)
  • Source:lactic acid bacteria, Lactococcus garvieae BCC 43578
  • Mass:5328 Da
  • Sequence Length:50 aa
  • Isoelectric Point:9.19
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001955    From 1 To 50 E-value: 2e-25 Score: 106
        EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH
  • 2. L12A06770|    From 21 To 70 E-value: 7e-24 Score: 100
        EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH
  • 3. L13A023739    From 1 To 50 E-value: 2e-23 Score: 99.8
        EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH
  • 4. L12A08865|    From 25 To 69 E-value: 0.00004 Score: 38.9
        LYDGANGYAYRDSQGHWAYKVTKTPAQALTDVVVNSWASGAASFA
  • 5. L12A08163|    From 41 To 64 E-value: 0.26 Score: 25.8
        GKTICKQTIDTASYTFGVMAEGWG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: