Record in detail


General Info

  • lamp_id:L03A000003
  • Name:DFA14_MOUSE
  • FullName:Alpha-defensin 14
  • Source:Mus musculus
  • Mass:9588.7 Da
  • Sequence Length:85 aa
  • Isoelectric Point:4.84
  • Activity:Antimicrobial
  • Sequence
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR
  • Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P50712
  •   2  Database:AMD  DEF14_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000003    From 1 To 85 E-value: 0 Score: 176
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR
  • 2. L03A000004    From 1 To 85 E-value: 3.9937e-43 Score: 164
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCCR
  • 3. L03A000176    From 14 To 93 E-value: 7.00649e-43 Score: 164
        AFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRREHMNGTCRKGHLMYTLCCR
  • 4. L03A000067    From 1 To 81 E-value: 1.00053e-42 Score: 163
        LAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRREHMNGTCRKGHLMYTLCCR
  • 5. L03A000182    From 15 To 93 E-value: 1.99965e-42 Score: 162
        FQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Huttner K.M.,Cano-Gauci D.F.,Nosek M.T.,Hsieh M.M.,Ouellette A.J.,
  •   Title:Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
  •   Journal:Infect. Immun., 1994, 62, 5040-5047  [MEDLINE:95012724]
  •   [2]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: