Record in detail


General Info

  • lamp_id:L03A000007
  • Name:ALO3_ACRLO
  • FullName:Antimicrobial peptide Alo-3
  • Source:Acrocinus longimanus
  • Mass:3712.2 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.89
  • Activity:Antimicrobial
  • Sequence
        CIKNGNGCQPNGSQGNCCSGCHKQPGWVAGYCRRK
  • Function:Has antifungal activity against C.glabrata.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P83653
  •   2  Database:AMD  ALO3_ACRLO

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000007    From 1 To 35 E-value: 0.000000000000004 Score: 72
        CIKNGNGCQPNGSQGNCCSGCHKQPGWVAGYCRRK
  • 2. L01A002685    From 1 To 36 E-value: 0.00000000000008 Score: 67.4
        CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
  • 3. L02A000813    From 1 To 36 E-value: 0.000000000002 Score: 63.2
        CIKNGNGCQPNGSQNGCCSGYCHKQPGWVAGYCRRK
  • 4. L01A002683    From 1 To 34 E-value: 0.00000000002 Score: 59.7
        CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR
  • 5. L01A002684    From 1 To 34 E-value: 0.00000000006 Score: 57.8
        CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR

Structure

  •   Domains
  •   1  Name:Antimicrobial_C6_CS    Interpro Link:IPR013006
  •   2  Name:Gurmarin/antifun_pep    Interpro Link:IPR009101
  •   3  Name:Gurmarin/antimicrobial_peptd    Interpro Link:IPR024206
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schott V.,Meyer J.-P.,Guenneugues M.,Landon C.,Barbault F.,
  •   Title:Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus.
  •   Journal:Biochemistry, 2003, 42, 14434-14442  [PubMed:14661954]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: