Record in detail


General Info

  • lamp_id:L03A000010
  • Name:DROS_DROME
  • FullName:Drosocin
  • Source:Drosophila melanogaster
  • Mass:7068.4 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11.81
  • Activity:Antimicrobial
  • Sequence
        MKFTIVFLLLACVFAMAVATPGKPRPYSPRPTSHPRPIRVRREALAIEDHLAQAAIRPPPILPA
  • Function:Antibacterial peptide with strong anti-Gram-negative bacteria activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P36193

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000010    From 1 To 64 E-value: 2e-31 Score: 125
        MKFTIVFLLLACVFAMAVATPGKPRPYSPRPTSHPRPIRVRREALAIEDHLAQAAIRPPPILPA
  • 2. L12A07893|    From 1 To 64 E-value: 1e-30 Score: 123
        MKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIRVRREALAIEDHLTQAAIRPPPILPA
  • 3. L01A000552    From 1 To 19 E-value: 0.000009 Score: 40.8
        GKPRPYSPRPTSHPRPIRV
  • 4. L11A010925    From 1 To 19 E-value: 0.00002 Score: 40
        GKPRPYSPRPTSHPKPIRV
  • 5. L11A010924    From 1 To 19 E-value: 0.00002 Score: 40
        GKPRPYSPKPTSHPRPIRV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Charlet M.,Lagueux M.,Hetru C.,Dimarcq J.-L.,Bulet P.,
  •   Title:A novel inducible antibacterial peptide of Drosophila carries an O-glycosylated substitution.
  •   Journal:J. Biol. Chem., 1993, 268, 14893-14897  [MEDLINE:93315464]
  •   [2]  Braun A.,Hoffmann D.,Reichhart J.-M.,Lagueux M.,Charlet M.,
  •   Title:Cloning of the gene encoding the antibacterial peptide drosocin involved in Drosophila immunity. Expression studies during the immune response.
  •   Journal:Eur. J. Biochem., 1996, 241, 699-706  [MEDLINE:97100194]
  •   [3]  Hoffmann J.A.,van Dorsselaer A.,Lagueux M.,Moniatte M.,Uttenweiler-Joseph S.,
  •   Title:Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1998, 95, 11342-11347  [MEDLINE:98409659]
  •   [4]  Craik D.J.,Hoffmann R.,Otvos L. Jr.,McManus A.M.,
  •   Title:Conformational studies by NMR of the antimicrobial peptide, drosocin, and its non-glycosylated derivative: effects of glycosylation on solution conformation.
  •   Journal:Biochemistry, 1999, 38, 705-714  [MEDLINE:99105821]
  •   [5]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [6]  Champe M.,Yu C.,Brokstein P.,Carlson J.W.,Stapleton M.,
  •   Title:A Drosophila full-length cDNA resource.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426066]
  •   [7]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [8]  Clark A.G.,Lazzaro B.P.,
  •   Title:Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster.
  •   Journal:Mol. Biol. Evol., 2003, 20, 914-923  [MEDLINE:22625906]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: