Record in detail


General Info

  • lamp_id:L03A000016
  • Name:DLP3_ORNAN
  • FullName:Defensin-like peptide 3
  • Source:Ornithorhynchus anatinus
  • Mass:4721.3 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.33
  • Activity:Antimicrobial
  • Sequence
        FEMQYCWSHSGVCRDKSERNNKPMAWTYCENRQKKCEF
  • Function:Does not show antimicrobial, myotoxic, hemolytic and cell-promoting activities.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P82141
  •   2  Database:AMD  DLP3_ORNAN
  •   3  Database:DEF  DEF110

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000016    From 1 To 38 E-value: 1e-18 Score: 83.2
        FEMQYCWSHSGVCRDKSERNNKPMAWTYCENRQKKCEF
  • 2. L03A000058    From 4 To 39 E-value: 0.00000000000001 Score: 70.1
        FEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKC
  • 3. L12A05115|    From 3 To 26 E-value: 0.056 Score: 28.1
        CWSLHGTCRDKCIKNE--MAYIFCMN
  • 4. L01A003493    From 7 To 35 E-value: 0.1 Score: 27.3
        CMGNSGICRASCKRNEQP--YLYCKNYQSCC
  • 5. L12A08219|    From 28 To 56 E-value: 0.28 Score: 25.8
        CMGNSGICRASCKKNEQP--YLYCRNYQACC

Structure

  •   Domains
  •   1  Name:Defensin_3    Interpro Link:IPR012553
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Alewood P.F.,Alewood D.,Fletcher J.I.,Wang X.,Torres A.M.,
  •   Title:Solution structure of a defensin-like peptide from platypus venom.
  •   Journal:Biochem. J., 1999, 341, 785-794  [MEDLINE:99348045]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: