Record in detail


General Info

  • lamp_id:L03A000027
  • Name:DLP1_ORNAN
  • FullName:Defensin-like peptide 1
  • Source:Ornithorhynchus anatinus
  • Mass:4958.6 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.12
  • Activity:Antimicrobial
  • Sequence
        FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
  • Function:Does not show antimicrobial, myotoxic, hemolytic and cell-promoting activities.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P82172
  •   2  Database:AMD  DLP1_ORNAN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000027    From 1 To 42 E-value: 3e-20 Score: 89
        FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
  • 2. L05ADEF385    From 26 To 61 E-value: 0.007 Score: 31.2
        RKHECQNMGGACKHQKTHGC-AILPADCKSRNKHCCR
  • 3. L05ADEF386    From 29 To 61 E-value: 0.008 Score: 30.8
        ECERMGGVCKHQKTHGC-SILPAECKSRNKHCCR
  • 4. L03A000058    From 9 To 40 E-value: 0.01 Score: 30.4
        CWSHSGVCRDKSERNCKPMAWTYCENRNQKCC
  • 5. L01A003605    From 8 To 41 E-value: 0.035 Score: 28.9
        RQCEKMGGICKYQKTHGC-SILPAECKSRYKHCCR

Structure

  •   Domains
  •   1  Name:Defensin_3    Interpro Link:IPR012553
  •   2  Name:Myo_neuro_toxin    Interpro Link:IPR023355
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Alewood P.F.,Alewood D.,Fletcher J.I.,Wang X.,Torres A.M.,
  •   Title:Solution structure of a defensin-like peptide from platypus venom.
  •   Journal:Biochem. J., 1999, 341, 785-794  [MEDLINE:99348045]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: