Record in detail
General Info
- lamp_id:L03A000053
- Name:STYC_STYCL
- FullName:Styelin-C
- Source:Styela clava
- Mass:3428.9 Da
- Sequence Length:31 aa
- Isoelectric Point:10.73
- Activity:Antimicrobial
- Sequence
GWFGKAFRSVSNFYKKHTYIHAGLSAATLLG - Function:Bactericidal against several Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:Uniprot O18494
- 2 Database:AMD STYC_STYCL
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000053 From 1 To 31 E-value: 0.0000000000006 Score: 64.7
GWFGKAFRSVSNFYKKHTYIHAGLSAATLLG - 2. L01A000424 From 1 To 31 E-value: 0.00000000005 Score: 58.2
GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL - 3. L13A025018 From 1 To 30 E-value: 0.0000000002 Score: 56.2
GWFGKAFRSVSNFYKKHKTYIHAGLSAATL - 4. L01A000425 From 1 To 17 E-value: 0.02 Score: 29.6
GXFGKAFXSVSNFAKKH - 5. L03A000054 From 1 To 17 E-value: 0.055 Score: 28.1
GXFGPAFHSVSNFAKKH
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Lehrer R.I.,Lee I.H.,Liaw L.,Zhao C.,
- Title:cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava.
- Journal:FEBS Lett., 1997, 412, 144-148 [MEDLINE:97400214]
Comments
- Comments
No comments found on LAMP database