Record in detail


General Info

  • lamp_id:L03A000058
  • Name:DLP2_ORNAN
  • FullName:Defensin-like peptide 2/4
  • Source:Ornithorhynchus anatinus
  • Mass:5114.8 Da
  • Sequence Length:42 aa
  • Isoelectric Point:7.76
  • Activity:Antimicrobial
  • Sequence
        IMFFEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY
  • Function:Does not show antimicrobial, myotoxic, hemolytic and cell-promoting activities.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P82140
  •   2  Database:AMD  DLP2_ORNAN
  •   3  Database:DEF  DEF294

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000058    From 1 To 42 E-value: 5e-21 Score: 91.3
        IMFFEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY
  • 2. L03A000016    From 1 To 36 E-value: 0.00000000000001 Score: 70.1
        FEMQYCWSHSGVCRDKSERNNKPMAWTYCENRQKKC
  • 3. L03A000027    From 9 To 40 E-value: 0.01 Score: 30.4
        CESINGVCRHKDTVNCREIFLADCYNDGQKCC
  • 4. L12A05115|    From 1 To 31 E-value: 0.035 Score: 28.9
        KKCWSLHGTCRDKCIKN--EMAYIFCMNGNLCC
  • 5. L01A003493    From 7 To 35 E-value: 0.93 Score: 23.9
        CMGNSGICRASCKRNEQP--YLYCKNY-QSCC

Structure

  •   Domains
  •   1  Name:Defensin_3    Interpro Link:IPR012553
  •   2  Name:Myo_neuro_toxin    Interpro Link:IPR023355
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Alewood P.F.,Alewood D.,Fletcher J.I.,Wang X.,Torres A.M.,
  •   Title:Solution structure of a defensin-like peptide from platypus venom.
  •   Journal:Biochem. J., 1999, 341, 785-794  [MEDLINE:99348045]
  •   [2]  Nicholson G.M.,Birinyi-Strachan L.C.,Doverskog M.,de Plater G.M.,Torres A.M.,
  •   Title:Defensin-like peptide-2 from platypus venom: member of a class of peptides with a distinct structural fold.
  •   Journal:Biochem. J., 2000, 348, 649-656  [MEDLINE:20300617]
  •   [3]  Alewood P.F.,Bansal P.S.,Geraghty D.P.,Tsampazi C.,Torres A.M.,
  •   Title:D-amino acid residue in a defensin-like peptide from platypus venom: effect on structure and chromatographic properties.
  •   Journal:Biochem. J., 2005, 391, 215-220  [PubMed:16033333]
  •   [4]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: