Record in detail


General Info

  • lamp_id:L03A000063
  • Name:PENK_BOVIN
  • FullName:Proenkephalin-A
  • Source:Bos taurus
  • Mass:3638 Da
  • Sequence Length:31 aa
  • Isoelectric Point:4.36
  • Activity:Antimicrobial
  • Sequence
        KRFAEPLPSEEEGESYSKEVPEMEKRYGGFM
  • Function:Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(111-130) and PENK(233-254) increase glutamate release in the striatum. PENK(111-130) decreases GABA concentration in the striatum.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P01211
  •   2  Database:AMD  ENK_BOVIN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000063    From 1 To 31 E-value: 0.000000000004 Score: 62
        KRFAEPLPSEEEGESYSKEVPEMEKRYGGFM
  • 2. L01A002850    From 1 To 29 E-value: 0.00000000005 Score: 58.2
        FAEPLPSEEEGESYSKEVPEMEKRYGGFM
  • 3. L02A000812    From 1 To 29 E-value: 0.0000000004 Score: 55.1
        FAEPLPSEEEGESYSKEPPEMEKRYGGFM
  • 4. L11A000647    From 1 To 29 E-value: 0.00003 Score: 38.9
        FAEPLPSEEEGEXYXKEVPEMEKRYGGFM
  • 5. L01A000128    From 18 To 29 E-value: 0.04 Score: 28.5
        VPEMEKRYGGFM

Structure

  •   Domains
  •   1  Name:Opioid_neupept    Interpro Link:IPR006024
  •   2  Name:Proenkphlin_A    Interpro Link:IPR000703
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hirose T.,Toyosato M.,Takahashi H.,Furutani Y.,Noda M.,
  •   Title:Cloning and sequence analysis of cDNA for bovine adrenal preproenkephalin.
  •   Journal:Nature, 1982, 295, 202-206  [MEDLINE:82125409]
  •   [2]  Udenfriend S.,Gage L.P.,Hoffman B.J.,Seeburg P.,Gubler U.,
  •   Title:Molecular cloning establishes proenkephalin as precursor of enkephalin-containing peptides.
  •   Journal:Nature, 1982, 295, 206-208  [MEDLINE:82125410]
  •   [3]  Crea R.,Herbert E.,Comb M.,
  •   Title:Partial characterization of the mRNA that codes for enkephalins in bovine adrenal medulla and human pheochromocytoma.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1982, 79, 360-364  [MEDLINE:82197495]
  •   [4]  Poteur L.,Nulans G.,Moniatte M.,Strub J.-M.,Goumon Y.,
  •   Title:The C-terminal bisphosphorylated proenkephalin-A-(209-237)-peptide from adrenal medullary chromaffin granules possesses antibacterial activity.
  •   Journal:Eur. J. Biochem., 1996, 235, 516-525  [MEDLINE:96184524]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: