Record in detail


General Info

  • lamp_id:L03A000070
  • Name:DFBC7_BOVIN
  • FullName:Beta-defensin C7
  • Source:Bos taurus
  • Mass:5649.8 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.74
  • Activity:Antimicrobial
  • Sequence
        LALLFLVLSAGSGISGPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW
  • Function:Has bactericidal activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  O18815
  •   2  Database:AMD  BDC7_BOVIN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000070    From 1 To 53 E-value: 1e-24 Score: 103
        LALLFLVLSAGSGISGPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW
  • 2. L12A09080|    From 16 To 60 E-value: 3e-19 Score: 85.5
        SAGSGISGPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
  • 3. L12A02357|    From 3 To 44 E-value: 2e-17 Score: 79.3
        QGISGPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
  • 4. L03A000261    From 16 To 60 E-value: 5e-17 Score: 78.2
        SAASGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 5. L05A0DEF83    From 1 To 38 E-value: 6e-17 Score: 77.8
        GPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Erdjument-Bromage H.,Russell J.P.,Diamond G.,Clark D.P.,Tarver A.P.,
  •   Title:Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
  •   Journal:Infect. Immun., 1998, 66, 1045-1056  [MEDLINE:98147718]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: