Record in detail


General Info

  • lamp_id:L03A000076
  • Name:DEFA4_MOUSE
  • FullName:Alpha-defensin 4
  • Source:Mus musculus
  • Mass:9911.2 Da
  • Sequence Length:89 aa
  • Isoelectric Point:7.21
  • Activity:Antimicrobial
  • Sequence
        LVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSISFGGQEGSALHEKSLRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P28311
  •   2  Database:AMD  DEF4_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08329|    From 4 To 92 E-value: 0 Score: 182
        LVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSISFGGQEGSALHEKSLRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 2. L03A000076    From 1 To 89 E-value: 0 Score: 182
        LVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSISFGGQEGSALHEKSLRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 3. L03A000003    From 1 To 73 E-value: 3e-29 Score: 119
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTC
  • 4. L03A000004    From 1 To 84 E-value: 7e-29 Score: 117
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCC
  • 5. L03A000071    From 1 To 81 E-value: 1e-27 Score: 113
        LLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRKRGCKRREHMNGTCRKGHLLYTLCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
  •   Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
  •   Journal:J. Cell Biol., 1992, 118, 929-936  [MEDLINE:92363933]
  •   [2]  Huttner K.M.,Cano-Gauci D.F.,Nosek M.T.,Hsieh M.M.,Ouellette A.J.,
  •   Title:Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
  •   Journal:Infect. Immun., 1994, 62, 5040-5047  [MEDLINE:95012724]
  •   [3]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]
  •   [4]  Yuan J.,Huttner K.M.,Tran D.,Darmoul D.,Ouellette A.J.,
  •   Title:Peptide localization and gene structure of cryptdin 4, a differentially expressed mouse Paneth cell alpha-defensin.
  •   Journal:Infect. Immun., 1999, 67, 6643-6651  [MEDLINE:20038333]
  •   [5]  Vogel H.J.,Ouellette A.J.,Tanabe H.,Hunter H.N.,Jing W.,
  •   Title:Solution structure of cryptdin-4, a mouse paneth cell alpha-defensin.
  •   Journal:Biochemistry, 2004, 43, 15759-15766  [PubMed:15595831]
  •   [6]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: