Record in detail


General Info

  • lamp_id:L03A000083
  • Name:DMS6_AGAAN
  • FullName:Dermaseptin AA-3-6
  • Source:Agalychnis annae
  • Mass:8816.9 Da
  • Sequence Length:80 aa
  • Isoelectric Point:4.31
  • Activity:Antimicrobial
  • Sequence
        MAFLKKSLFLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGMWSTIRNVGKSAAKAANLPAKAALGAISEAVGEQ
  • Function:Possesses a potent antimicrobial activity against Gram-positive and Gram-negative bacteria. Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  O93226
  •   2  Database:AMD  DMS6_AGAAN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000083    From 1 To 80 E-value: 1.99993e-41 Score: 159
        MAFLKKSLFLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGMWSTIRNVGKSAAKAANLPAKAALGAISEAVGEQ
  • 2. L12A06203|    From 1 To 56 E-value: 5e-19 Score: 84.7
        MAFMKKSLFLVLFLGMVSLSICEEEKRENEDEAKQEDDEQSEMKRGLWSTIKNVGK
  • 3. L12A05358|    From 1 To 67 E-value: 0.000000000000005 Score: 71.6
        KSLFLVLFLGMVSLSICEEEKRENEDEEKQEDDEQSEMKRGLWSTIKNVGKEAAIAAG---KAVLGSLGE
  • 4. L12A06199|    From 1 To 56 E-value: 0.000000000000005 Score: 71.6
        MAFLKKSLFLVLFLGMVSLSICEEEKRENEDEELQEDDEQSEMKRGLWSTIKNVGK
  • 5. L12A06177|    From 1 To 62 E-value: 0.00000000000003 Score: 68.9
        MAFLKKSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLLSVLGSVAKHV

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wechselberger C.
  •   Title:Cloning of cDNAs encoding new peptides of the dermaseptin-family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1388, 279-283  [MEDLINE:98449786]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: