Record in detail


General Info

  • lamp_id:L03A000085
  • Name:DRG3_PHYBI
  • FullName:Dermaseptin DRG3
  • Source:Phyllomedusa bicolor
  • Mass:8443.5 Da
  • Sequence Length:75 aa
  • Isoelectric Point:4.31
  • Activity:Antimicrobial
  • Sequence
        MAFLKKSLFLVLFLGLVSLSVCEEEKRENEDEEEQEDDEQSEEKRALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • Function:Has antimicrobial activity. Exhibits a bactericidal activity towards several species of mollicutes, firmicutes and gracilicutes. This peptide is membranotropic and it efficiently depolarizes the plasma membrane.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P81488
  •   2  Database:AMD  DMS7_PHYBI

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06197|    From 1 To 75 E-value: 7e-38 Score: 147
        MAFLKKSLFLVLFLGLVSLSVCEEEKRENEDEEEQEDDEQSEEKRALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 2. L03A000085    From 1 To 75 E-value: 8e-38 Score: 147
        MAFLKKSLFLVLFLGLVSLSVCEEEKRENEDEEEQEDDEQSEEKRALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 3. L12A06201|    From 1 To 74 E-value: 0.000000000000004 Score: 71.6
        MAFLKKSVFLVLFLGLVSLSICEEEKREEENEEKQEDDEQSEEKRALWKNMLKGIGKLAGQAALGAVKTLVGAE
  • 4. L12A06203|    From 1 To 56 E-value: 0.00000000000002 Score: 69.7
        MAFMKKSLFLVLFLGMVSLSICEEEKRENEDEAKQEDDEQSEMKRGLWST-IKNVGK
  • 5. L12A06177|    From 1 To 63 E-value: 0.00000000000009 Score: 67.4
        MAFLKKSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLL--------SVLGSVAKHVL

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wroblewski H.,Amiche M.,Beven L.,Vouille V.,Fleury Y.,
  •   Title:Synthesis, antimicrobial activity and gene structure of a novel member of the dermaseptin B family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1396, 228-236  [MEDLINE:98201715]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: