Record in detail


General Info

  • lamp_id:L03A000088
  • Name:DEF2_CAPAN
  • FullName:Defensin J1-2
  • Source:Capsicum annuum
  • Mass:8248.7 Da
  • Sequence Length:74 aa
  • Isoelectric Point:9.05
  • Activity:Antimicrobial
  • Sequence
        MAGFSKVIATIFLMMMLVFATGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC
  • Function:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  O65740
  •   2  Database:AMD  PDEF2_CAPAN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000088    From 1 To 74 E-value: 2e-38 Score: 149
        MAGFSKVIATIFLMMMLVFATGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC
  • 2. L12A06235|    From 1 To 77 E-value: 5e-34 Score: 134
        MAGYPKVVATVFLMMMLVFATEMGPMVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC
  • 3. L03A000089    From 1 To 74 E-value: 9e-25 Score: 103
        MAGFSKVVATIFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPC
  • 4. L03A000162    From 6 To 77 E-value: 1e-23 Score: 100
        RLISAVLIMFMIFVATGMGPVTVEARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 5. L01A002864    From 1 To 47 E-value: 1e-22 Score: 96.7
        RTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schantz R.,Schantz M.L.,Pozueta-Romero J.,Houlne G.,Meyer B.,
  •   Title:Fruit-specific expression of a defensin-type gene family in bell pepper. Upregulation during ripening and upon wounding.
  •   Journal:Plant Physiol., 1996, 112, 615-622  [MEDLINE:97037730]
  •   [2]  Schantz R.,Meyer B.,Houlne G.,
  •   Title:Alteration of the expression of a plant defensin gene by exon shuffling in bell pepper (Capsicum annuum L.).
  •   Journal:Mol. Gen. Genet., 1998, 259, 504-510  [MEDLINE:99005242]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: