Record in detail


General Info

  • lamp_id:L03A000096
  • Name:DEF13_ARATH
  • FullName:Defensin-like protein 13
  • Source:Arabidopsis thaliana
  • Mass:8709.1 Da
  • Sequence Length:80 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        MAKSATIVTLFFAALVFFAALEAPMVVEAQKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • Function:Confers broad-spectrum resistance to pathogens. Possesses antifungal activity sensitive to inorganic cations in vitro.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000096    From 1 To 80 E-value: 9.94922e-44 Score: 166
        MAKSATIVTLFFAALVFFAALEAPMVVEAQKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 2. L12A06263|    From 1 To 80 E-value: 1e-38 Score: 149
        MAKFASIIALLFAALVLFAAFEAPTMVEAQKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
  • 3. L05ADEF279    From 1 To 80 E-value: 2e-38 Score: 149
        MAKSAAIITFLFAALVLFAAFEAPIMVEAQKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYFPC
  • 4. L05ADEF273    From 1 To 80 E-value: 4e-38 Score: 148
        MAKSATIITFLFAALVLFAAFEAPTMVEAQKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
  • 5. L01A002125    From 1 To 80 E-value: 9e-38 Score: 147
        MAKFASIIALLFAALVLFAAFEAETMVEAQKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vanderleyden J.,Osborn R.W.,van Leuven F.,Torrekens S.,Terras F.R.G.,
  •   Title:A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.
  •   Journal:FEBS Lett., 1993, 316, 233-240  [MEDLINE:93138130]
  •   [2]  Delseny M.,Grellet F.,Laudie M.,Raynal M.,Cooke R.,
  •   Title:Further progress towards a catalogue of all Arabidopsis genes: analysis of a set of 5000 non-redundant ESTs.
  •   Journal:Plant J., 1996, 9, 101-124  [MEDLINE:96158348]
  •   [3]  De Samblanx G.W.,Thomma B.P.H.J.,Terras F.R.G.,Eggermont K.,Penninckx I.A.M.A.,
  •   Title:Pathogen-induced systemic activation of a plant defensin gene in Arabidopsis follows a salicylic acid-independent pathway.
  •   Journal:Plant Cell, 1996, 8, 2309-2323  [PubMed:8989885]
  •   [4]  Meyerowitz E.M.,Clark S.E.,Williams R.W.,
  •   Title:Genetic and physical characterization of a region of Arabidopsis chromosome 1 containing the CLAVATA1 gene.
  •   Journal:Plant Mol. Biol., 1999, 39, 171-176  [MEDLINE:99178804]
  •   [5]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [6]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [7]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [8]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]
  •   [9]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [10]  Cammue B.P.A.,Proost P.,Aerts A.M.,Delaure S.L.,Sels J.,
  •   Title:Use of a PTGS-MAR expression system for efficient in planta production of bioactive Arabidopsis thaliana plant defensins.
  •   Journal:Transgenic Res., 2007, 16, 531-538  [PubMed:17180735]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: