Record in detail


General Info

  • lamp_id:L03A000101
  • Name:HEPC_MOUSE
  • FullName:Hepcidin
  • Source:Mus musculus
  • Mass:9351.9 Da
  • Sequence Length:83 aa
  • Isoelectric Point:8.5
  • Activity:Antimicrobial
  • Sequence
        MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT
  • Function:Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q9EQ21
  •   2  Database:AMD  HEPC_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000101    From 1 To 83 E-value: 9.80909e-45 Score: 169
        MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT
  • 2. L01A003127    From 1 To 54 E-value: 3e-24 Score: 102
        QMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCE
  • 3. L12A06333|    From 1 To 84 E-value: 2e-18 Score: 82.8
        MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMLQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
  • 4. L01A001835    From 1 To 84 E-value: 3e-18 Score: 82
        MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
  • 5. L12A06331|    From 1 To 85 E-value: 7e-17 Score: 77.8
        MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQGQLDRAGARAGWTPMLQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Structure

  •   Domains
  •   1  Name:Hepcidin    Interpro Link:IPR010500
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Turlin B.,Leroyer P.,Courselaud B.,Ilyin G.,Pigeon C.,
  •   Title:A new mouse liver-specific gene, encoding a protein homologous to human antimicrobial peptide hepcidin, is overexpressed during iron overload.
  •   Journal:J. Biol. Chem., 2001, 276, 7811-7819  [MEDLINE:21269329]
  •   [2]  Grandchamp B.,Beaumont C.,Devaux I.,Bennoun M.,Nicolas G.,
  •   Title:Lack of hepcidin gene expression and severe tissue iron overload in upstream stimulatory factor 2 (USF2) knockout mice.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2001, 98, 8780-8785  [MEDLINE:21353006]
  •   [3]  Alizadeh M.,Pigeon C.,Troadec M.-B.,Courselaud B.,Ilyin G.,
  •   Title:Comparative analysis of mouse hepcidin 1 and 2 genes: evidence for different patterns of expression and co-inducibility during iron overload.
  •   Journal:FEBS Lett., 2003, 542, 22-26  [MEDLINE:22615571]
  •   [4]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: