Record in detail


General Info

  • lamp_id:L03A000102
  • Name:HEPC_PIG
  • FullName:Hepcidin
  • Source:Sus scrofa
  • Mass:8770.4 Da
  • Sequence Length:82 aa
  • Isoelectric Point:8.68
  • Activity:Antimicrobial
  • Sequence
        MALSVQIRAACLLLLLLVSLTAGSVLPSQTRQLTDLRTQDTAGATAGLTPVAQRLRRDTHFPICIFCCGCCRKAICGMCCKT
  • Function:Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q8MJ80
  •   2  Database:AMD  HEPC_PIG

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000102    From 1 To 82 E-value: 6.00036e-42 Score: 160
        MALSVQIRAACLLLLLLVSLTAGSVLPSQTRQLTDLRTQDTAGATAGLTPVAQRLRRDTHFPICIFCCGCCRKAICGMCCKT
  • 2. L12A06320|    From 1 To 81 E-value: 3e-31 Score: 125
        MALNAQIRATCILLLL-VSLTSGFVLPPQTRQLADLQTQDTAGAAAGLTPVLQRLRRDTHIPICMFCCGCCFKATCGLCCRT
  • 3. L12A06325|    From 1 To 82 E-value: 1e-30 Score: 123
        MALNTQIRATCLLLLVLLSLTSGSVLPPQTRQLTDLQTKDTAGAAAGLTPVLQRRRRDTHFPICIFCCGCCRKGTCGMCCRT
  • 4. L12A06321|    From 1 To 81 E-value: 6e-28 Score: 114
        MALNAQIRATCLLLLL-VSLTSGFVLPPQTSQLADLQTQDTAGAAAGLTPVLQRLRRDTHIPICTFCCGCCFKATCGLCCRT
  • 5. L12A09361|    From 1 To 82 E-value: 1e-26 Score: 110
        MSLNTRIQAVCLLLLILASLTSASVLLHQTRQLADLQTQDTAGATAGWTPGLQRLRRDTHFPICVFCCGCCYKSKCGICCKT

Structure

  •   Domains
  •   1  Name:Hepcidin    Interpro Link:IPR010500
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: