Record in detail


General Info

  • lamp_id:L03A000104
  • Name:CTXC1_CERCA
  • FullName:Ceratotoxin-C
  • Source:Ceratitis capitata
  • Mass:6828.4 Da
  • Sequence Length:67 aa
  • Isoelectric Point:10.41
  • Activity:Antimicrobial
  • Sequence
        MANIKAVFLICIVAFIAFHCVVAEPTAEDSVVVKRSLGGVISGAKKVAKVAIPIGKAVLPVVAKLVG
  • Function:Female-specific peptides with potent activity against Gram-positive and Gram-negative bacteria. They have as well hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000104    From 1 To 67 E-value: 2e-31 Score: 125
        MANIKAVFLICIVAFIAFHCVVAEPTAEDSVVVKRSLGGVISGAKKVAKVAIPIGKAVLPVVAKLVG
  • 2. L12A06366|    From 1 To 71 E-value: 2e-21 Score: 92.4
        MANLKAVFLICIVAFIAFQCVVAEPAAEDSIVVKRSIGSALKKALPVAKKIGKIALPIAKAALPVAAGLVG
  • 3. L12A06367|    From 1 To 71 E-value: 7e-21 Score: 90.9
        MANLKAVFLICIVAFIALQCVVAEPAAEDSVVVKRSIGSALKKALPVAKKIGKIALPIAKAALPVAAGLVG
  • 4. L01A000292    From 1 To 32 E-value: 0.0000000001 Score: 57.4
        SLGGVISGAKKVAKVAIPIGKAVLPVVAKLVG
  • 5. L01A000001    From 13 To 36 E-value: 0.001 Score: 33.5
        AKKVGKVAIPIAKAVLSVVGQLVG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Amons R.,Marri L.,Giordano P.C.,Manetti A.G.O.,Rosetto M.,
  •   Title:Molecular characterization of ceratotoxin C, a novel antibacterial female-specific peptide of the ceratotoxin family from the medfly Ceratitis capitata.
  •   Journal:Eur. J. Biochem., 1996, 241, 330-337  [MEDLINE:97075000]
  •   [2]  Baldari C.T.,Marchini D.,Manetti A.G.O.,de Filippis T.,Rosetto M.,
  •   Title:The genes encoding the antibacterial sex-specific peptides ceratotoxins are clustered in the genome of the medfly Ceratitis capitata.
  •   Journal:Insect Biochem. Mol. Biol., 1997, 27, 1039-1046  [MEDLINE:98231103]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: