Record in detail


General Info

  • lamp_id:L03A000109
  • Name:DEF_VIGUN
  • FullName:Defensin-like protein
  • Source:Vigna unguiculata
  • Mass:8522.8 Da
  • Sequence Length:75 aa
  • Isoelectric Point:7.12
  • Activity:Antimicrobial
  • Sequence
        MEKKSIAGLCFLFLVLFVAQEVVVQSEAKTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • Function:This protein is required for germination.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P18646
  •   2  Database:AMD  PDEF_VIGUN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000109    From 1 To 75 E-value: 9.99995e-41 Score: 156
        MEKKSIAGLCFLFLVLFVAQEVVVQSEAKTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
  • 2. L05ADEF409    From 1 To 75 E-value: 1e-37 Score: 146
        MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
  • 3. L11A002570    From 1 To 75 E-value: 3e-37 Score: 145
        MEKKSLAGLCFLFLVLFVAQEVVLQTEAKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC
  • 4. L11A005850    From 1 To 75 E-value: 9e-36 Score: 140
        MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC
  • 5. L11A002571    From 1 To 72 E-value: 7e-31 Score: 124
        MEKKSLAGLCFLFLVLFVAQEIMV-TEAATCENLANTYRGPCF--GGCDFHCKTKEHLLSGRCRDDFRCWCTRNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Minamikawa T.,Yamauchi D.,Ishibashi N.,
  •   Title:Stored mRNA in cotyledons of Vigna unguiculata seeds: nucleotide sequence of cloned cDNA for a stored mRNA and induction of its synthesis by precocious germination.
  •   Journal:Plant Mol. Biol., 1990, 15, 59-64  [MEDLINE:91355865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: