Record in detail


General Info

  • lamp_id:L03A000114
  • Name:Q6T418_VIGRA
  • FullName:
  • Source:Vigna radiata
  • Mass:8159.6 Da
  • Sequence Length:73 aa
  • Isoelectric Point:8.59
  • Activity:Antimicrobial
  • Sequence
        MERKTFSFLFLLLLVLASDVAVERGEARTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • Function:null

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q6T418
  •   2  Database:AMD  PDEF1_VIGRA

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000114    From 1 To 73 E-value: 1e-38 Score: 150
        MERKTFSFLFLLLLVLASDVAVERGEARTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 2. L01A002676    From 1 To 46 E-value: 8e-23 Score: 97.4
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 3. L02A000989    From 1 To 46 E-value: 2e-22 Score: 95.9
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
  • 4. L02A000715    From 1 To 45 E-value: 6e-21 Score: 90.9
        RTCM-KKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 5. L11A005878    From 2 To 44 E-value: 2e-18 Score: 82.4
        VRTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCK----TCYCLVNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chen C.S.,Hsu M.P.,Lai S.M.,Cheng C.S.,Liu Y.J.,
  •   Title:Solution structure of the plant defensin VrD1 from mung bean and its possible role in insecticidal activity against bruchids.
  •   Journal:Proteins, 2006, 63, 777-786  [PubMed:16544327]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: