Record in detail


General Info

  • lamp_id:L03A000117
  • Name:RLXN_LITCT
  • FullName:Ranalexin
  • Source:Lithobates catesbeiana
  • Mass:7614.9 Da
  • Sequence Length:66 aa
  • Isoelectric Point:5.11
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLGTINLSLCEEERNAEEERRDNPDERDVEVEKRFLGGLIKIVPAMICAVTKKC
  • Function:Potent microbicidal activity, active against S.aureus and E.coli. It acts as well as a membrane-disruptive agent at higher concentrations.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000117    From 1 To 66 E-value: 3e-33 Score: 132
        MFTLKKSLLLLFFLGTINLSLCEEERNAEEERRDNPDERDVEVEKRFLGGLIKIVPAMICAVTKKC
  • 2. L12A07345|    From 1 To 67 E-value: 3e-24 Score: 102
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKLLPSLLCMISRKC
  • 3. L12A07221|    From 1 To 67 E-value: 1e-22 Score: 97.1
        MFTMKKPMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKRLPSLFCLITRRC
  • 4. L12A07365|    From 1 To 70 E-value: 4e-22 Score: 95.1
        MFTTKKPMLLLFFLGTINFSLCEQERDAEEERRDDQDKRDVEVEKRFFLPLLGAAAQVLPSLICKIFKKC
  • 5. L12A07168|    From 1 To 71 E-value: 9e-22 Score: 94
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_1    Interpro Link:IPR012520
  •   2  Name:Brevinin    Interpro Link:IPR004275
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zasloff M.,Maloy W.L.,Durell S.,Clark D.P.,
  •   Title:Ranalexin. A novel antimicrobial peptide from bullfrog (Rana catesbeiana) skin, structurally related to the bacterial antibiotic, polymyxin.
  •   Journal:J. Biol. Chem., 1994, 269, 10849-10855  [MEDLINE:94193792]
  •   [2]  Grassy G.,Chiche L.,Roch P.,Chavanieu A.,Vignal E.,
  •   Title:Solution structure of the antimicrobial peptide ranalexin and a study of its interaction with perdeuterated dodecylphosphocholine micelles.
  •   Journal:Eur. J. Biochem., 1998, 253, 221-228  [MEDLINE:98237592]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: