Record in detail


General Info

  • lamp_id:L03A000118
  • Name:BR1E_RANES
  • FullName:Brevinin-1E
  • Source:Rana esculenta
  • Mass:8266.5 Da
  • Sequence Length:71 aa
  • Isoelectric Point:4.63
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSMLLLFFLGTINLSLCEEERDADEEERRDNPDESEVEVEKRFLPLLAGLAANFLPKIFCKITRKC
  • Function:Shows antibacterial activity against representative Gram-negative and Gram-positive bacterial species, and a very high hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000118    From 1 To 71 E-value: 5e-36 Score: 141
        MFTLKKSMLLLFFLGTINLSLCEEERDADEEERRDNPDESEVEVEKRFLPLLAGLAANFLPKIFCKITRKC
  • 2. L12A07168|    From 1 To 71 E-value: 3e-32 Score: 129
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC
  • 3. L01A003834    From 1 To 71 E-value: 3e-31 Score: 125
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVANFLPQIICKIARKC
  • 4. L12A07293|    From 1 To 71 E-value: 1e-27 Score: 113
        MFTMKKSLLLLFFLGTINLSLCEQERNADEEERRDDPDERDVEVEKRFLPLIASLAANFVPKIFCKITKKC
  • 5. L12A07071|    From 1 To 70 E-value: 3e-26 Score: 108
        MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDPDERDVEVEKRFLPLLAGLAANFLPKLFCKITRK

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_1    Interpro Link:IPR012520
  •   2  Name:Brevinin    Interpro Link:IPR004275
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bossa F.,Barra D.,Mignogna G.,Simmaco M.,
  •   Title:Novel antimicrobial peptides from skin secretion of the European frog Rana esculenta.
  •   Journal:FEBS Lett., 1993, 324, 159-161  [MEDLINE:93285327]
  •   [2]  Bossa F.,Barra D.,Mignogna G.,Simmaco M.,
  •   Title:Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides.
  •   Journal:J. Biol. Chem., 1994, 269, 11956-11961  [MEDLINE:94216303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: