Record in detail


General Info

  • lamp_id:L03A000119
  • Name:GGN4_GLARU
  • FullName:Gaegurin-4
  • Source:Glandirana rugosa
  • Mass:8695 Da
  • Sequence Length:80 aa
  • Isoelectric Point:4.79
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLFLFFLGTISLSLCEEERSADEDDGGEMTEEEVKRGILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • Function:Has a non-hemolytic activity. Has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000119    From 1 To 80 E-value: 9.99995e-41 Score: 156
        MFTMKKSLLFLFFLGTISLSLCEEERSADEDDGGEMTEEEVKRGILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • 2. L01A003830    From 1 To 74 E-value: 5e-26 Score: 108
        MFTSKKSLLVLFFLGTISLSFCEEERNADEDD-GEMT-EEVKRGILDTLKEF----GKTAAKGIAQSLLSTASCKLAKTC
  • 3. L12A07339|    From 1 To 76 E-value: 9e-25 Score: 103
        MFTMKKSLLVLFFLGTISLSLCQEERNADEEDGGEATEEEVKRSFLTTFKDLAIKAA----KSAGQSVLSTLSCKLSNTC
  • 4. L12A07231|    From 1 To 75 E-value: 3e-24 Score: 102
        MFTMKKSLLFLFFLGTISLSFCEEERSADEDDEGEMTEEE-KRSIRDKIKTIA----IDLAKGAGTGVLKTLICKLDKSC
  • 5. L12A07224|    From 1 To 80 E-value: 5e-24 Score: 101
        MFTMKKSILVLFFLGTISLSLCEQERSADEDDGEEIKEEEVKRGIFSLFKTAAKFVGKNLLKEAGKAGLEHLACKVKNEC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   2  Name:Brevinin    Interpro Link:IPR004275
  •   3  Name:EF_Hand_1_Ca_BS    Interpro Link:IPR018247
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lee B.J.,Jung J.-E.,Park J.M.,
  •   Title:Antimicrobial peptides from the skin of a Korean frog, Rana rugosa.
  •   Journal:Biochem. Biophys. Res. Commun., 1994, 205, 948-954  [MEDLINE:95091844]
  •   [2]  Lee B.J.,Park J.M.,Carlson B.A.,Kwon S.Y.,
  •   Title:Structural organization and expression of the gaegurin 4 gene of Rana rugosa.
  •   Journal:Biochim. Biophys. Acta, 2000, 1492, 185-190  [MEDLINE:20461774]
  •   [3]  Park Y.H.,Lee S.H.,Kim D.H.,Kim J.S.,Chi S.W.,
  •   Title:Solution structure and membrane interaction mode of an antimicrobial peptide gaegurin 4.
  •   Journal:Biochem. Biophys. Res. Commun., 2007, 352, 592-597  [PubMed:17141187]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: