Record in detail


General Info

  • lamp_id:L03A000130
  • Name:Q9BK52_ACALU
  • FullName:
  • Source:Acalolepta luxuriosa
  • Mass:9575.2 Da
  • Sequence Length:83 aa
  • Isoelectric Point:9.15
  • Activity:Antimicrobial
  • Sequence
        MKFFITFTFVLSLVVLTVYSAPREFAEPEEQDEGHFRVKRFTCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000130    From 1 To 83 E-value: 4.2039e-45 Score: 171
        MKFFITFTFVLSLVVLTVYSAPREFAEPEEQDEGHFRVKRFTCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR
  • 2. L01A002994    From 1 To 43 E-value: 7e-21 Score: 91.3
        FTCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR
  • 3. L12A12243|    From 3 To 64 E-value: 3e-20 Score: 88.6
        LDQVEEQDEHQVAHIRVRRVTCDLLSAEAKGVKVNHAACAAHCLLKRKRGGYCNKRRICVCR
  • 4. L03A000163    From 1 To 84 E-value: 2e-19 Score: 86.3
        MKLTI-FALVACFFILQIAAFPLEEAATAEEIEQGE-HIRVKRVTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR
  • 5. L01A000291    From 2 To 43 E-value: 4e-16 Score: 75.5
        TCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sato R.,Saito A.,Imamura M.,Ueda K.,
  •   Title:Purification and cDNA cloning of an insect defensin from larvae of the longicorn beetle, Acalolepta luxuriosa.
  •   Journal:Appl. Entomol. Zool. (Jpn.), 2005, 40, 335-345  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: