Record in detail


General Info

  • lamp_id:L03A000131
  • Name:DEFI_PROTE
  • FullName:Phormicin
  • Source:Protophormia terraenovae
  • Mass:10109.7 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8
  • Activity:Antimicrobial
  • Sequence
        MKFFMVFVVTFCLAVCFVSQSLAIPADAANDAHFVDGVQALKEIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN
  • Function:Responsible for the anti Gram-positive activity of immune hemolymph of P.terraenovae.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000131    From 1 To 94 E-value: 0 Score: 194
        MKFFMVFVVTFCLAVCFVSQSLAIPADAANDAHFVDGVQALKEIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN
  • 2. L03A000167    From 1 To 94 E-value: 2e-36 Score: 142
        MKSFIVLAVTLCLAAFFMGQSVASPAAAAEESKFVDGLHALKTIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN
  • 3. L03A000132    From 1 To 97 E-value: 7e-27 Score: 110
        MKFFSLFPVILVVVACLTMRANAAPSAGDEVDHHPDYVDGVEALRQLEPELHGRYKRATCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK
  • 4. L03A000136    From 1 To 92 E-value: 7e-19 Score: 84.3
        MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQ--HSRQKRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
  • 5. L02A000216    From 1 To 40 E-value: 1e-18 Score: 83.6
        ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_insect    Interpro Link:IPR017982
  •   2  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Reichhart J.-M.,Wicker C.,Dimarcq J.-L.,Keppi E.,Lambert J.,
  •   Title:Insect immunity: isolation from immune blood of the dipteran Phormia terranovae of two insect antibacterial peptides with sequence homology to rabbit lung macrophage bactericidal peptides.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1989, 86, 262-266  [MEDLINE:89098894]
  •   [2]  Reichhart J.-M.,Hoffmann D.,Hoffmann J.A.,Zachary D.,Dimarcq J.-L.,
  •   Title:Insect immunity: expression of the two major inducible antibacterial peptides, defensin and diptericin, in Phormia terranovae.
  •   Journal:EMBO J., 1990, 9, 2507-2515  [MEDLINE:90316108]
  •   [3]  Dimarcq J.-L.,Keppi E.,Roecklin D.,Bitsch F.,Lepage P.,
  •   Title:Determination of disulfide bridges in natural and recombinant insect defensin A.
  •   Journal:Eur. J. Biochem., 1991, 196, 735-742  [MEDLINE:91192047]
  •   [4]  Simorre J.-P.,Gincel E.,Petit M.-C.,Genest M.,Bonmatin J.-M.,
  •   Title:Progress in multidimensional NMR investigations of peptide and protein 3-D structures in solution. From structure to functional aspects.
  •   Journal:Biochimie, 1992, 74, 825-836  [MEDLINE:93104264]
  •   [5]  Ptak M.,Hoffmann J.A.,Hetru C.,Bonmatin J.-M.,Cornet B.,
  •   Title:Refined three-dimensional solution structure of insect defensin A.
  •   Journal:Structure, 1995, 3, 435-448  [MEDLINE:95393015]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: