Record in detail


General Info

  • lamp_id:L03A000134
  • Name:HIS3_HUMAN
  • FullName:Histatin-3
  • Source:Homo sapiens
  • Mass:6149.1 Da
  • Sequence Length:51 aa
  • Isoelectric Point:10.6
  • Activity:Antimicrobial
  • Sequence
        MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
  • Function:Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. His3-(20-43)-peptide (histatin-5) is especially effective against C.albicans and C.neoformans, and inhibits Lys-gingipain and Arg-gingipain (rgpB) from P.gingivalis. In addition, His3-(20-43)-peptide is a potent inhibitor of metalloproteinases MMP2 and MMP9.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000134    From 1 To 51 E-value: 5e-25 Score: 104
        MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
  • 2. L12A07825|    From 1 To 51 E-value: 2e-24 Score: 102
        MKFFVFALILALMLSMTGADSHEKRHHGYKRKFHEKHHSHRGYRSNYLYDN
  • 3. L12A07826|    From 1 To 51 E-value: 1e-23 Score: 100
        MKFFVFALILALMLSMTGADSHEKRHHGYKRKSHEKHHSHRGYRSNYLYDN
  • 4. L12A07827|    From 1 To 51 E-value: 2e-23 Score: 99.4
        MKFFVFALILALMVSMTGADSHEKRHHGYKRKSHEKHHSHRGYRSNYLYDN
  • 5. L12A07814|    From 1 To 51 E-value: 2e-22 Score: 96.3
        MKFFIFALILALVISMTGADSHEKRHHGYRRKSHEKHHSHRGYRSNYLYDN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Levine M.J.,Ridall A.L.,Dickinson D.P.,
  •   Title:Human submandibular gland statherin and basic histidine-rich peptide are encoded by highly abundant mRNA"s derived from a common ancestral sequence.
  •   Journal:Biochem. Biophys. Res. Commun., 1987, 149, 784-790  [MEDLINE:88106506]
  •   [2]  Diamond R.D.,Levitz S.M.,McMillian F.M.,Xu T.,Oppenheim F.G.,
  •   Title:Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans.
  •   Journal:J. Biol. Chem., 1988, 263, 7472-7477  [MEDLINE:88227937]
  •   [3]  Azen E.A.,Sabatini L.M.,
  •   Title:Histatins, a family of salivary histidine-rich proteins, are encoded by at least two loci (HIS1 and HIS2).
  •   Journal:Biochem. Biophys. Res. Commun., 1989, 160, 495-502  [MEDLINE:89246491]
  •   [4]  Oppenheim F.G.,Troxler R.F.,Offner G.D.,Vanderspek J.C.,
  •   Title:Molecular cloning of human submandibular histatins.
  •   Journal:Arch. Oral Biol., 1990, 35, 137-143  [MEDLINE:90262442]
  •   [5]  Ogata K.,Ogino T.,Sugiyama K.,
  •   Title:Rapid purification and characterization of histatins (histidine-rich polypeptides) from human whole saliva.
  •   Journal:Arch. Oral Biol., 1990, 35, 415-419  [MEDLINE:90321151]
  •   [6]  Chen Z.W.
  •   Title:Nucleotide sequence analysis of the human salivary protein genes HIS1 and HIS2, and evolution of the STATH/HIS gene family.
  •   Journal:Mol. Biol. Evol., 1993, 10, 497-511  [MEDLINE:93330039]
  •   [7]  Azen E.A.,Sabatini L.M.,
  •   Title:Two coding change mutations in the HIS2(2) allele characterize the salivary histatin 3-2 protein variant.
  •   Journal:Hum. Mutat., 1994, 4, 12-19  [MEDLINE:95038764]
  •   [8]  Bobek L.A.,Raj P.A.,Tsai H.,
  •   Title:Candidacidal activity of recombinant human salivary histatin-5 and variants.
  •   Journal:Infect. Immun., 1996, 64, 5000-5007  [MEDLINE:97101011]
  •   [9]  Troxler R.F.,Potempa J.,Helmerhorst E.J.,Travis J.,Gusman H.,
  •   Title:Salivary histatin 5 is an inhibitor of both host and bacterial enzymes implicated in periodontal disease.
  •   Journal:Infect. Immun., 2001, 69, 1402-1408  [PubMed:11179305]
  •   [10]  Oppenheim F.G.,Troxler R.F.,McKnight C.J.,Grogan J.,
  •   Title:Zinc and copper bind to unique sites of histatin 5.
  •   Journal:FEBS Lett., 2001, 491, 76-80  [MEDLINE:21125113]
  •   [11]  Edgerton M.,Baev D.,Reddy M.S.,Li X.S.,
  •   Title:Candida albicans Ssa1/2p is the cell envelope binding protein for human salivary histatin 5.
  •   Journal:J. Biol. Chem., 2003, 278, 28553-28561  [PubMed:12761219]
  •   [12]  Cabras T.,Olmi C.,Rossetti D.V.,Inzitari R.,Castagnola M.,
  •   Title:A cascade of 24 histatins (histatin 3 fragments) in human saliva. Suggestions for a pre-secretory sequential cleavage pathway.
  •   Journal:J. Biol. Chem., 2004, 279, 41436-41443  [PubMed:15272024]
  •   [13]  Hand A.R.,Helmerhorst E.J.,Oppenheim F.G.,Piludu M.,Ahmad M.,
  •   Title:Immunocytochemical localization of histatins in human salivary glands.
  •   Journal:J. Histochem. Cytochem., 2004, 52, 361-370  [PubMed:14966203]
  •   [14]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [15]  Inzitari R.,Amado F.,Monteiro J.A.,Fanali C.,Cabras T.,
  •   Title:Tyrosine polysulfation of human salivary histatin 1. A post-translational modification specific of the submandibular gland.
  •   Journal:J. Proteome Res., 2007, 6, 2472-2480  [PubMed:17503797]
  •   [16]  Vitorino R.,Duarte J.A.,Domingues P.,Lobo M.J.,Amado F.,
  •   Title:Salivary peptidomics.
  •   Journal:Expert Rev. Proteomics, 2010, 7, 709-721  [PubMed:20973643]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: